Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RWDD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156862
Description
RWDD1 Polyclonal specifically detects RWDD1 in Human samples. It is validated for Western Blot.Specifications
RWDD1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
A8MT24 | |
RWDD1 | |
Synthetic peptides corresponding to RWDD1(RWD domain containing 1) The peptide sequence was selected from the middle region of RWDD1. Peptide sequence KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ. | |
100 μL | |
Proteases & Other Enzymes | |
51389 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DFRP2, DRG family-regulatory protein 2, PTD013, RWD domain containing 1, RWD domain-containing protein 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Pig: 92%; Xenopus: 78%; Zebrafish: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title