RXR beta/NR2B2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152812

Catalog No. NBP152812

Description

RXR beta/NR2B2 Polyclonal specifically detects RXR beta/NR2B2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RXR beta/NR2B2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DAUDI6, H-2RIIBP, MHC class I promoter binding protein, NR2B2MGC1831, Nuclear receptor subfamily 2 group B member 2, RCoR-1, retinoic acid receptor RXR-beta, Retinoid X receptor beta, retinoid X receptor, beta
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Guinea pig: 78%.
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P28702
• Gene Symbols: RXRB
• Immunogen: Synthetic peptides corresponding to RXRB(retinoid X receptor, beta) The peptide sequence was selected from the N terminal of RXRB. Peptide sequence PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA.
• Quantity: 100 μL
• Research Discipline: Cancer, Neuroscience, Transcription Factors and Regulators, Vision
• Gene ID (Entrez): 6257
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.