Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RXR beta/NR2B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | RXR beta/NR2B2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP152812
|
Novus Biologicals
NBP152812 |
100 μL |
Each for $436.00
|
N/A |
NB15281220
|
Novus Biologicals
NBP15281220UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
RXR beta/NR2B2 Polyclonal specifically detects RXR beta/NR2B2 in Human samples. It is validated for Western Blot.Specifications
RXR beta/NR2B2 | |
Polyclonal | |
Rabbit | |
Cancer, Neuroscience, Transcription Factors and Regulators, Vision | |
P28702 | |
6257 | |
Synthetic peptides corresponding to RXRB(retinoid X receptor, beta) The peptide sequence was selected from the N terminal of RXRB. Peptide sequence PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DAUDI6, H-2RIIBP, MHC class I promoter binding protein, NR2B2MGC1831, Nuclear receptor subfamily 2 group B member 2, RCoR-1, retinoic acid receptor RXR-beta, Retinoid X receptor beta, retinoid X receptor, beta | |
RXRB | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title