Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RXR beta/NR2B2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen RXR beta/NR2B2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP152812
View Documents
Novus Biologicals
NBP152812
100 μL
Each for $436.00
N/A
NB15281220
View Documents
Novus Biologicals
NBP15281220UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

RXR beta/NR2B2 Polyclonal specifically detects RXR beta/NR2B2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RXR beta/NR2B2
Polyclonal
Rabbit
Cancer, Neuroscience, Transcription Factors and Regulators, Vision
P28702
6257
Synthetic peptides corresponding to RXRB(retinoid X receptor, beta) The peptide sequence was selected from the N terminal of RXRB. Peptide sequence PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
DAUDI6, H-2RIIBP, MHC class I promoter binding protein, NR2B2MGC1831, Nuclear receptor subfamily 2 group B member 2, RCoR-1, retinoic acid receptor RXR-beta, Retinoid X receptor beta, retinoid X receptor, beta
RXRB
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit