Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RXR gamma/NR2B3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RXR gamma/NR2B3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15281520
|
Novus Biologicals
NBP15281520UL |
20 μL |
Each for $152.22
|
|
NBP152815
|
Novus Biologicals
NBP152815 |
100 μL |
Each for $436.00
|
|
Description
RXR gamma/NR2B3 Polyclonal specifically detects RXR gamma/NR2B3 in Human samples. It is validated for Western Blot.Specifications
| RXR gamma/NR2B3 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Transcription Factors and Regulators | |
| P48443 | |
| 6258 | |
| Synthetic peptides corresponding to RXRG(retinoid X receptor, gamma) The peptide sequence was selected from the N terminal of RXRG. Peptide sequence NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| NR2B3retinoid X receptor-gamma, Nuclear receptor subfamily 2 group B member 3, retinoic acid receptor RXR-gamma, Retinoid X receptor gamma, retinoid X receptor, gamma, RXRC | |
| RXRG | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title