Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
S100A7A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309472100UL
Description
S100A7A Polyclonal specifically detects S100A7A in Human samples. It is validated for Western Blot.Specifications
S100A7A | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
protein S100-A7A, NICE-2, S100 calcium binding protein A7A, S100A15, S100A7f, S100A7L1 | |
The immunogen is a synthetic peptide directed towards the middle region of Human S100A7A (NP_789793). Peptide sequence CDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPC | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
338324 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction