Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

S1P2/EDG-5/S1PR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31006825UL

 View more versions of this product

Catalog No. NB125038



S1P2/EDG-5/S1PR2 Polyclonal specifically detects S1P2/EDG-5/S1PR2 in Human samples. It is validated for Western Blot.


PBS buffer, 2% sucrose
AGR16, EDG5, EDG-5, endothelial differentiation G-protein coupled receptor 5, endothelial differentiation, sphingolipid G-protein-coupled receptor, 5, Gpcr13, H218, LPB2, S1P receptor 2, S1P receptor Edg-5, S1P receptor EDG5, S1P2, sphingosine 1-phosphate receptor 2, sphingosine 1-phosphate receptor Edg-5, sphingosine-1-phosphate receptor 2
The immunogen is a synthetic peptide directed towards the middle region of human S1P2/EDG-5/S1PR2 (NP_004221.3). Peptide sequence VHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGV
25 μg
Western Blot
Western Blot 1.0 ug/ml
Affinity purified
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Certifications


Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit