Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
S1P2/EDG-5/S1PR2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310068100UL
Description
S1P2/EDG-5/S1PR2 Polyclonal specifically detects S1P2/EDG-5/S1PR2 in Human samples. It is validated for Western Blot.Specifications
S1P2/EDG-5/S1PR2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
AGR16, EDG5, EDG-5, endothelial differentiation G-protein coupled receptor 5, endothelial differentiation, sphingolipid G-protein-coupled receptor, 5, Gpcr13, H218, LPB2, S1P receptor 2, S1P receptor Edg-5, S1P receptor EDG5, S1P2, sphingosine 1-phosphate receptor 2, sphingosine 1-phosphate receptor Edg-5, sphingosine-1-phosphate receptor 2 | |
The immunogen is a synthetic peptide directed towards the middle region of human S1P2/EDG-5/S1PR2 (NP_004221.3). Peptide sequence VHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGV | |
100 μg | |
GPCR | |
9294 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction