Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

S1P5/EDG-8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody


Antigen S1P5/EDG-8
Immunogen Synthetic peptides corresponding to EDG8(endothelial differentiation, sphingolipid G-protein-coupled receptor, 8) The peptide sequence was selected from the N terminal of EDG8. Peptide sequence MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLA
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP160048 View Documents Novus BiologicalsSupplier Diversity Partner
100 ul This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


S1P5/EDG-8 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.


Affinity Purified
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Synthetic peptides corresponding to EDG8(endothelial differentiation, sphingolipid G-protein-coupled receptor, 8) The peptide sequence was selected from the N terminal of EDG8. Peptide sequence MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLA
Edg-8, EDG8S1P receptor Edg-8, Endothelial differentiation G-protein-coupled receptor 8, endothelial differentiation, sphingolipid G-protein-coupled receptor, 8, S1P receptor 5, S1P5, sphingosine 1-phosphate receptor 5, sphingosine 1-phosphate receptor EDG8, Sphingosine 1-phosphate receptor Edg-8, sphingosine-1-phosphate receptor 5, SPPR-1, SPPR-2
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit