Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SAMD8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16011320UL
Description
SAMD8 Polyclonal specifically detects SAMD8 in Human samples. It is validated for Western Blot.Specifications
SAMD8 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q5JSC8 | |
SAMD8 | |
Synthetic peptides corresponding to SAMD8(sterile alpha motif domain containing 8) The peptide sequence was selected from the middle region of SAMD8 (NP_653261). Peptide sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL. | |
20 μL | |
Lipid and Metabolism | |
142891 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ25082, SAM domain-containing protein 8, SMSr, sphingomyelin synthase related, sphingomyelin synthase-related protein 1, sterile alpha motif domain containing 8, Sterile alpha motif domain-containing protein 8 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction