SAPS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157815

Catalog No. NBP157815

Description

SAPS1 Polyclonal specifically detects SAPS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SAPS1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: KIAA1115MGC138185, PP6R1MGC142003, protein phosphatase 6, regulatory subunit 1, SAP190, SAPS domain family member 1, SAPS domain family, member 1, SAPS1serine/threonine-protein phosphatase 6 regulatory subunit 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22870
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PPP6R1
• Immunogen: Synthetic peptides corresponding to PPP6R1 (protein phosphatase 6, regulatory subunit 1) Antibody(against the N terminal of PPP6R1. Peptide sequence MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Canine: 92%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG