Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SAPS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SAPS1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15781520
View Documents
Novus Biologicals
NBP15781520UL
20 μL
Each for $152.22
Add to cart
 
NBP157815
View Documents
Novus Biologicals
NBP157815
100 μL
Each for $436.00
Add to cart
 
Description

Description

SAPS1 Polyclonal specifically detects SAPS1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SAPS1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
22870
Synthetic peptides corresponding to PPP6R1 (protein phosphatase 6, regulatory subunit 1) Antibody(against the N terminal of PPP6R1. Peptide sequence MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
KIAA1115MGC138185, PP6R1MGC142003, protein phosphatase 6, regulatory subunit 1, SAP190, SAPS domain family member 1, SAPS domain family, member 1, SAPS1serine/threonine-protein phosphatase 6 regulatory subunit 1
PPP6R1
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit