Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SARG Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SARG |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170451
|
Novus Biologicals
NBP170451 |
100 μL |
Each of 1 for $436.00
|
|
Description
SARG Polyclonal specifically detects SARG in Human samples. It is validated for Western Blot.Specifications
SARG | |
Polyclonal | |
Rabbit | |
chromosome 1 open reading frame 116, DKFZp666H2010, MGC2742 | |
C1ORF116 | |
IgG | |
Affinity Purified | |
37 kDa |
Western Blot | |
Unconjugated | |
RUO | |
79098 | |
Synthetic peptides corresponding to C1ORF116 The peptide sequence was selected from the middle region of C1ORF116. Peptide sequence SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title