Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SASH3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15688720UL
Description
SASH3 Polyclonal specifically detects SASH3 in Human, Mouse samples. It is validated for Western Blot.Specifications
SASH3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8K352 | |
SASH3 | |
Synthetic peptides corresponding to CXORF9 The peptide sequence was selected from the N terminal of CXORF9. Peptide sequence KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM. | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CXorf9, HACS2, SAM and SH3 domain containing 3, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SH3D6C, SLYchromosome X open reading frame 9,753P9 | |
Rabbit | |
Affinity Purified | |
RUO | |
54440 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction