Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SASH3 Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00


Antigen SASH3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
20 μL
Each for $152.22
Add to cart
View Documents
Novus Biologicals
100 μL
Each for $436.00
Add to cart


SASH3 Polyclonal specifically detects SASH3 in Human, Mouse samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
CXorf9, HACS2, SAM and SH3 domain containing 3, SAM and SH3 domain-containing protein 3, SH3 protein expressed in lymphocytes homolog, SH3D6C, SLYchromosome X open reading frame 9,753P9
Affinity Purified
Western Blot
Synthetic peptides corresponding to CXORF9 The peptide sequence was selected from the N terminal of CXORF9. Peptide sequence KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM.
Store at -20C. Avoid freeze-thaw cycles.
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit