Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAMP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SCAMP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SCAMP1 Polyclonal specifically detects SCAMP1 in Mouse samples. It is validated for Western Blot.Specifications
SCAMP1 | |
Polyclonal | |
Rabbit | |
NP_083429 | |
9522 | |
The immunogen for this antibody is Scamp1. Peptide sequence GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
secretory carrier membrane protein 1SCAMP37SCAMP, secretory carrier-associated membrane protein 1 | |
SCAMP1 | |
IgG | |
38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title