Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCARA3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SCARA3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179201
|
Novus Biologicals
NBP179201 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SCARA3 Polyclonal specifically detects SCARA3 in Mouse samples. It is validated for Western Blot.Specifications
| SCARA3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| APC7, CSR1, CSRCellular stress response gene protein, macrophage scavenger receptor-like 1, MSLR1cellular stress response protein, MSRL1, scavenger receptor class A member 3, scavenger receptor class A, member 3 | |
| SCARA3 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_766192 | |
| 51435 | |
| The immunogen for this antibody is Scara3. Peptide sequence KTIQTTLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title