SCCPDH Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160126

Catalog No. NBP160126

Description

SCCPDH Polyclonal specifically detects SCCPDH in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SCCPDH
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NBX0
• Gene Symbols: SCCPDH
• Immunogen: Synthetic peptides corresponding to SCCPDH(saccharopine dehydrogenase (putative)) The peptide sequence was selected from the C terminal of SCCPDH. Peptide sequence FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 85%.
• Target Species: Human, Rat, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CGI-49, EC 1.5.1.9, FLJ43187, NET11, probable saccharopine dehydrogenase, RP11-439E19.2, saccharopine dehydrogenase (putative)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51097
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.