Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCCPDH Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | SCCPDH |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160126
|
Novus Biologicals
NBP160126 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
SCCPDH Polyclonal specifically detects SCCPDH in Human samples. It is validated for Western Blot.Specifications
SCCPDH | |
Polyclonal | |
Rabbit | |
Q8NBX0 | |
51097 | |
Synthetic peptides corresponding to SCCPDH(saccharopine dehydrogenase (putative)) The peptide sequence was selected from the C terminal of SCCPDH. Peptide sequence FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CGI-49, EC 1.5.1.9, FLJ43187, NET11, probable saccharopine dehydrogenase, RP11-439E19.2, saccharopine dehydrogenase (putative) | |
SCCPDH | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title