Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCCPDH Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SCCPDH |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP160126
|
Novus Biologicals
NBP160126 |
100 μL |
Each for $436.00
|
|
NBP1602620
|
Novus Biologicals
NBP16012620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SCCPDH Polyclonal specifically detects SCCPDH in Human samples. It is validated for Western Blot.Specifications
| SCCPDH | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CGI-49, EC 1.5.1.9, FLJ43187, NET11, probable saccharopine dehydrogenase, RP11-439E19.2, saccharopine dehydrogenase (putative) | |
| SCCPDH | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8NBX0 | |
| 51097 | |
| Synthetic peptides corresponding to SCCPDH(saccharopine dehydrogenase (putative)) The peptide sequence was selected from the C terminal of SCCPDH. Peptide sequence FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title