Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SDC3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SDC3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP174216
|
Novus Biologicals
NBP174216 |
100 μL |
Each of 1 for $436.00
|
|
Description
SDC3 Polyclonal specifically detects SDC3 in Mouse samples. It is validated for Western Blot.Specifications
SDC3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
KIAA0468, N-syndecan, SDCN, SYND3syndecan proteoglycan 3, syndecan 3, syndecan 3 (N-syndecan), syndecan neural type, syndecan-3 | |
SDC3 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q64519 | |
9672 | |
Synthetic peptides corresponding to the N terminal of Sdc3. Immunizing peptide sequence GLLLPPLLLLLLAGRAAGAQRWRNENFERPVDLEGSGDDDSFPDDELDDL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title