Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SDK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $461.00
Specifications
Antigen | SDK1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19159320
|
Novus Biologicals
NBP19159320UL |
20 μL |
Each for $204.00
|
|
|||||
NBP191593
|
Novus Biologicals
NBP191593 |
100 μL |
Each for $461.00
|
|
|||||
Description
SDK1 Polyclonal specifically detects SDK1 in Human samples. It is validated for Western Blot.Specifications
SDK1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
protein sidekick-1, sidekick homolog 1, cell adhesion molecule (chicken) | |
SDK1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_001073121 | |
221935 | |
Synthetic peptide directed towards the middle region of human SDK1. Peptide sequence AVNEAGYGEPSNPSTAVSAQVEAPFYEEWWFLLVMALSSLIVILLVVFAL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title