SDSL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153180

Catalog No. NBP153180

Description

SDSL Polyclonal specifically detects SDSL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SDSL
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96GA7
• Gene Symbols: SDSL
• Immunogen: Synthetic peptides corresponding to SDSL(serine dehydratase-like) The peptide sequence was selected from the middle region of SDSL. Peptide sequence ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ.
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 113675
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 4.3.1.17, EC 4.3.1.19, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDH, SDH 2, SDS-RS1, Serine dehydratase 2, serine dehydratase related sequence 1, serine dehydratase-like, TDH
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 85%.
• Target Species: Human, Equine, Rabbit
• Isotype: IgG