Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SDSL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SDSL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP153180
View Documents
Novus Biologicals
NBP153180
100 μL
Each for $436.00
Add to cart
 
NBP15318020
View Documents
Novus Biologicals
NBP15318020UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

SDSL Polyclonal specifically detects SDSL in Human samples. It is validated for Western Blot.
Specifications

Specifications

SDSL
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 4.3.1.17, EC 4.3.1.19, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDH, SDH 2, SDS-RS1, Serine dehydratase 2, serine dehydratase related sequence 1, serine dehydratase-like, TDH
SDSL
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q96GA7
113675
Synthetic peptides corresponding to SDSL(serine dehydratase-like) The peptide sequence was selected from the middle region of SDSL. Peptide sequence ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit