Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SDSL Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SDSL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP153180
|
Novus Biologicals
NBP153180 |
100 μL |
Each for $436.00
|
|
NBP15318020
|
Novus Biologicals
NBP15318020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SDSL Polyclonal specifically detects SDSL in Human samples. It is validated for Western Blot.Specifications
| SDSL | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 4.3.1.17, EC 4.3.1.19, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDH, SDH 2, SDS-RS1, Serine dehydratase 2, serine dehydratase related sequence 1, serine dehydratase-like, TDH | |
| SDSL | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96GA7 | |
| 113675 | |
| Synthetic peptides corresponding to SDSL(serine dehydratase-like) The peptide sequence was selected from the middle region of SDSL. Peptide sequence ALAAIYSGLLRRLQAEGCLPPSLTSVVVIVCGGNNINSRELQALKTHLGQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title