Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SDSL Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15317920UL

 View more versions of this product

Catalog No. NBP15317920


Add to cart

Description

Description

SDSL Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SDSL
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
SDSL
Synthetic peptides corresponding to SDSL(serine dehydratase-like) The peptide sequence was selected from the N terminal of SDSL. Peptide sequence MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR.
Immunogen affinity purified
RUO
Primary
113675
Western Blot
Western Blot 1:100-1:2000
Q96GA7
EC 4.3.1.17, EC 4.3.1.19, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDH, SDH 2, SDS-RS1, Serine dehydratase 2, serine dehydratase related sequence 1, serine dehydratase-like, TDH
Rabbit
IgG
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit