Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEC13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258235

Catalog No. NBP258235


Add to cart

Description

Description

SEC13 Polyclonal antibody specifically detects SEC13 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

SEC13
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
D3S1231ESEC13L1npp-20, protein SEC13 homolog, SEC13 (S. cerevisiae)-like 1, SEC13 homolog (S. cerevisiae), SEC13L1, SEC13-like 1 isoform, SEC13-like protein 1, SEC13-related protein, SEC13RSEC13-like 1 (S. cerevisiae)
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
SEC13
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD
Affinity purified
RUO
Primary
6396
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only