Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEC31A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SEC31A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SEC31A Polyclonal specifically detects SEC31A in Rat samples. It is validated for Western Blot.Specifications
SEC31A | |
Polyclonal | |
Rabbit | |
NP_148981 | |
22872 | |
Synthetic peptide directed towards the N terminal of human Sec31aThe immunogen for this antibody is Sec31a. Peptide sequence DKEVVIAQKDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ABP125ABP130KIAA0905Web1-like protein, DKFZp686N07171, HSPC334, MGC90305, protein transport protein Sec31A, protein-transport protein SEC31, SEC31 homolog A (S. cerevisiae), SEC31L1, SEC31-like 1, SEC31-like 1 (S. cerevisiae), SEC31-like protein 1, SEC31-related protein A, yeast Sec31p homolog | |
SEC31A | |
IgG | |
136 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title