Secretory phospholipase A2 Type V Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157906

Catalog No. NBP157906

Description

Secretory phospholipase A2 Type V Polyclonal specifically detects Secretory phospholipase A2 Type V in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Secretory phospholipase A2 Type V
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P39877
• Gene Symbols: PLA2G5
• Immunogen: Synthetic peptides corresponding to PLA2G5(phospholipase A2, group V) The peptide sequence was selected from the middle region of PLA2G5. Peptide sequence YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism, Stem Cell Markers
• Gene ID (Entrez): 5322
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: Ca2+-dependent phospholipase A2, calcium-dependent phospholipase A2, DKFZp686C2294, EC 3.1.1.4, Group V phospholipase A2, GV-PLA2, hVPLA(2), MGC46205, Phosphatidylcholine 2-acylhydrolase 5, phospholipase A2, group V, PLA2-10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 92%; Bovine: 85%.
• Target Species: Human, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG