Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Secretory phospholipase A2 Type V Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Secretory phospholipase A2 Type V
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157906
View Documents
Novus Biologicals
NBP157906
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Secretory phospholipase A2 Type V Polyclonal specifically detects Secretory phospholipase A2 Type V in Human samples. It is validated for Western Blot.
Specifications

Specifications

Secretory phospholipase A2 Type V
Polyclonal
Rabbit
Lipid and Metabolism, Stem Cell Markers
Ca2+-dependent phospholipase A2, calcium-dependent phospholipase A2, DKFZp686C2294, EC 3.1.1.4, Group V phospholipase A2, GV-PLA2, hVPLA(2), MGC46205, Phosphatidylcholine 2-acylhydrolase 5, phospholipase A2, group V, PLA2-10
PLA2G5
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
P39877
5322
Synthetic peptides corresponding to PLA2G5(phospholipase A2, group V) The peptide sequence was selected from the middle region of PLA2G5. Peptide sequence YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit