Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Secretory phospholipase A2 Type V Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Secretory phospholipase A2 Type V |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157906
|
Novus Biologicals
NBP157906 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Secretory phospholipase A2 Type V Polyclonal specifically detects Secretory phospholipase A2 Type V in Human samples. It is validated for Western Blot.Specifications
| Secretory phospholipase A2 Type V | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism, Stem Cell Markers | |
| Ca2+-dependent phospholipase A2, calcium-dependent phospholipase A2, DKFZp686C2294, EC 3.1.1.4, Group V phospholipase A2, GV-PLA2, hVPLA(2), MGC46205, Phosphatidylcholine 2-acylhydrolase 5, phospholipase A2, group V, PLA2-10 | |
| PLA2G5 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P39877 | |
| 5322 | |
| Synthetic peptides corresponding to PLA2G5(phospholipase A2, group V) The peptide sequence was selected from the middle region of PLA2G5. Peptide sequence YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title