Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SEPHS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15516720UL

 View more versions of this product

Catalog No. NBP15516720


Add to cart

Description

Description

SEPHS1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SEPHS1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
SEPHS1
Synthetic peptides corresponding to SEPHS1(selenophosphate synthetase 1) The peptide sequence was selected from the C terminal of SEPHS1 (NP_036379). Peptide sequence PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS.
43 kDa
20ul
Stem Cell Markers
Primary
22929
Western Blot
Western Blot 5 ug/ml
P49903
EC 2.7.9.3, MGC4980, SELD, Selenium donor protein 1, Selenophosphate synthase 1, selenophosphate synthetase 1, selenophosphate synthetase 1 +E9a, selenophosphate synthetase 1 delta E2, selenophosphate synthetase 1 delta E8, selenophosphate synthetase 1 major, SPS1selenophosphate synthetase 1 +E9, water dikinase 1
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit