Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEPN1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | SEPN1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16905820
|
Novus Biologicals
NBP16905820UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP169058
|
Novus Biologicals
NBP169058 |
100 μL |
Each for $482.50
|
|
|||||
Description
SEPN1 Polyclonal specifically detects SEPN1 in Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SEPN1 | |
| Unconjugated | |
| RUO | |
| FLJ24021, rigid spine muscular dystrophy 1, RSMD1, RSS, selenoprotein N, selenoprotein N, 1, SelN, SELNMDRS1 | |
| SEPN1 | |
| IgG | |
| 62 kDa |
| Polyclonal | |
| Rabbit | |
| D3Z5N3 | |
| 57190 | |
| Synthetic peptides corresponding to Sepn1 (selenoprotein N, 1) The peptide sequence was selected from the C terminal of Sepn1. Peptide sequence VHHINANYFLDITSMKPEDMENNNVFSFSSSFEDPSTATYMQFLREGLRR. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title