Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Septin-12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | Septin-12 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1581720
![]() |
Novus Biologicals
NBP15811720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP158117
![]() |
Novus Biologicals
NBP158117 |
100 μL |
Each for $487.50
|
|
|||||
Description
Septin-12 Polyclonal specifically detects Septin-12 in Human samples. It is validated for Western Blot.Specifications
Septin-12 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
FLJ25410, septin 12, septin-12 | |
43355 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q8IYM1 | |
124404 | |
Synthetic peptides corresponding to Septin-12. The peptide sequence was selected from the middle region of 40433. Peptide sequence LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title