Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Septin-12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158117

 View more versions of this product

Catalog No. NBP158117


Add to cart

Description

Description

Septin-12 Polyclonal specifically detects Septin-12 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Septin-12
Polyclonal
Western Blot 1.0 ug/ml
Q8IYM1
43355
Synthetic peptides corresponding to Septin-12. The peptide sequence was selected from the middle region of 40433. Peptide sequence LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD.
100 μL
Cell Cycle and Replication
124404
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ25410, septin 12, septin-12
Rabbit
Affinity Purified
RUO
Primary
Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Canine: 92%; Aspergillus clavatus: 91%; Aspergillus nidulans: 91%; Sartorya fumigata: 91%; Aspergillus oryzae: 91%; Wangiella dermatitidis: 91%; Aspergillus nidulans FGSC A4: 91%; Atlantic salmon: 90%; Moniliophthora perniciosa FA553: 90%; Soil fungus: 90%; Green puffer: 90%; Zebrafish: 90%; Xenopus: 84%; Harpegnathos saltator: 84%; Western clawed frog: 84%; Camponotus floridanus: 84%; Yeast: 83%; Neurospora crassa: 83%; Valley fever fungus: 83%; Filobasidiella neoformans: 83%; Glume blotch fungus: 83%; Fission yeast: 83%; Blackleg fungus: 83%; Tunicate: 83%; Pyrenophora teres f. teres 0-1: 83%; Glomerella graminicola M1.001: 83%; Trichoplax reptans: 83%; Podospora anserina: 83%; Paracoccidioides brasiliensis: 83%; Arthroderma gypseum CBS 118893: 83%; Body louse: 76%;.
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
IgG
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit