Septin-12 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158117

Catalog No. NBP158117

Description

Septin-12 Polyclonal specifically detects Septin-12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Septin-12
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8IYM1
• Gene Symbols: 43355
• Immunogen: Synthetic peptides corresponding to Septin-12. The peptide sequence was selected from the middle region of 40433. Peptide sequence LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 124404
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ25410, septin 12, septin-12
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Canine: 92%; Aspergillus clavatus: 91%; Aspergillus nidulans: 91%; Sartorya fumigata: 91%; Aspergillus oryzae: 91%; Wangiella dermatitidis: 91%; Aspergillus nidulans FGSC A4: 91%; Atlantic salmon: 90%; Moniliophthora perniciosa FA553: 90%; Soil fungus: 90%; Green puffer: 90%; Zebrafish: 90%; Xenopus: 84%; Harpegnathos saltator: 84%; Western clawed frog: 84%; Camponotus floridanus: 84%; Yeast: 83%; Neurospora crassa: 83%; Valley fever fungus: 83%; Filobasidiella neoformans: 83%; Glume blotch fungus: 83%; Fission yeast: 83%; Blackleg fungus: 83%; Tunicate: 83%; Pyrenophora teres f. teres 0-1: 83%; Glomerella graminicola M1.001: 83%; Trichoplax reptans: 83%; Podospora anserina: 83%; Paracoccidioides brasiliensis: 83%; Arthroderma gypseum CBS 118893: 83%; Body louse: 76%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG