Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Septin-12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158117
Description
Septin-12 Polyclonal specifically detects Septin-12 in Human samples. It is validated for Western Blot.Specifications
Septin-12 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
FLJ25410, septin 12, septin-12 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Canine: 92%; Aspergillus clavatus: 91%; Aspergillus nidulans: 91%; Sartorya fumigata: 91%; Aspergillus oryzae: 91%; Wangiella dermatitidis: 91%; Aspergillus nidulans FGSC A4: 91%; Atlantic salmon: 90%; Moniliophthora perniciosa FA553: 90%; Soil fungus: 90%; Green puffer: 90%; Zebrafish: 90%; Xenopus: 84%; Harpegnathos saltator: 84%; Western clawed frog: 84%; Camponotus floridanus: 84%; Yeast: 83%; Neurospora crassa: 83%; Valley fever fungus: 83%; Filobasidiella neoformans: 83%; Glume blotch fungus: 83%; Fission yeast: 83%; Blackleg fungus: 83%; Tunicate: 83%; Pyrenophora teres f. teres 0-1: 83%; Glomerella graminicola M1.001: 83%; Trichoplax reptans: 83%; Podospora anserina: 83%; Paracoccidioides brasiliensis: 83%; Arthroderma gypseum CBS 118893: 83%; Body louse: 76%;. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8IYM1 | |
43355 | |
Synthetic peptides corresponding to Septin-12. The peptide sequence was selected from the middle region of 40433. Peptide sequence LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD. | |
100 μL | |
Cell Cycle and Replication | |
124404 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction