Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Septin-6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152840

 View more versions of this product

Catalog No. NBP152840


Add to cart

Description

Description

Septin-6 Polyclonal antibody specifically detects Septin-6 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

Septin-6
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
KIAA0128SEP2septin 2, MGC16619, MGC20339, SEPT2, septin 6, septin-6
Rabbit
IgG
100 ul
Cell Cycle and Replication
Primary
23157
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:100-1:2000
Affinity Purified
43349
Synthetic peptides corresponding to SEPT6(septin 6) The peptide sequence was selected from the N terminal of 40427. Peptide sequence TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV.
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Bovine: 100%; Canine: 100%; Rat: 92%; Zebra finch: 91%; Sumatran orangutan: 83%; Crab-eating macaque: 83%; Green puffer: 78%; Chicken: 78%; Zebrafish: 78%;.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit