Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Septin-6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | Septin-6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP152840
|
Novus Biologicals
NBP152840 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
Septin-6 Polyclonal specifically detects Septin-6 in Human samples. It is validated for Western Blot.Specifications
Septin-6 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
23157 | |
Synthetic peptides corresponding to SEPT6(septin 6) The peptide sequence was selected from the N terminal of 40427. Peptide sequence TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA0128SEP2septin 2, MGC16619, MGC20339, SEPT2, septin 6, septin-6 | |
43349 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title