Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SERBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SERBP1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157211
|
Novus Biologicals
NBP157211 |
100 μL |
Each of 1 for $436.00
|
|
Description
SERBP1 Polyclonal specifically detects SERBP1 in Human samples. It is validated for Western Blot.Specifications
SERBP1 | |
Polyclonal | |
Rabbit | |
CGI-55, CHD3IP, chromodomain helicase DNA binding protein 3 interacting protein, DKFZP564M2423, HABP4L, PAI-1 mRNA binding protein, PAI1 RNA-binding protein 1, PAI-RBP1DKFZp564M2423, PAIRBP1FLJ90489, plasminogen activator inhibitor 1 RNA binding protein, plasminogen activator inhibitor 1 RNA-binding protein, SERPINE1 mRNA binding protein 1, SERPINE1 mRNA-binding protein 1 | |
SERBP1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
26135 | |
Synthetic peptides corresponding to SERBP1(SERPINE1 mRNA binding protein 1) The peptide sequence was selected from the middle region of SERBP1. Peptide sequence SYNYSDLDQSNVTEETPEGEEHHPVADTENKENEVEEVKEEGPKEMTLDE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title