Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Serine Dehydratase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Serine Dehydratase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Serine Dehydratase Polyclonal specifically detects Serine Dehydratase in Human samples. It is validated for Western Blot.Specifications
Serine Dehydratase | |
Polyclonal | |
Rabbit | |
P20132 | |
10993 | |
Synthetic peptides corresponding to SDS(serine dehydratase) The peptide sequence was selected from the N terminal of SDS (NP_006834) Peptide sequence AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
EC 4.3.1.17, EC 4.3.1.19, L-serine ammonia-lyase, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, SDHL-serine dehydratase, serine dehydratase, TDH | |
SDS | |
IgG | |
35 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title