Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Serpin A4/Kallistatin Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen Serpin A4/Kallistatin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17974320
View Documents
Novus Biologicals
NBP17974320UL
20 μL
Each for $152.22
Add to cart
 
NBP179743
View Documents
Novus Biologicals
NBP179743
100 μL
Each for $436.00
Add to cart
 
Description

Description

Serpin A4/Kallistatin Polyclonal specifically detects Serpin A4/Kallistatin in Human samples. It is validated for Western Blot.
Specifications

Specifications

Serpin A4/Kallistatin
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
antitrypsin), member 4, KAL, kallistatin, KLST, KSTKallikrein inhibitor, member 4, PI-4, PI4Peptidase inhibitor 4, protease inhibitor 4 (kallistatin), serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, Serpin A4, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin)
SERPINA4
IgG
Affinity Purified
48 kDa
Western Blot
Unconjugated
RUO
NP_006206
5267
Synthetic peptide directed towards the middle region of human SERPINA4. Peptide sequence KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit