Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Serpin A4/Kallistatin Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | Serpin A4/Kallistatin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17974320
|
Novus Biologicals
NBP17974320UL |
20 μL |
Each for $152.22
|
|
NBP179743
|
Novus Biologicals
NBP179743 |
100 μL |
Each for $436.00
|
|
Description
Serpin A4/Kallistatin Polyclonal specifically detects Serpin A4/Kallistatin in Human samples. It is validated for Western Blot.Specifications
| Serpin A4/Kallistatin | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| antitrypsin), member 4, KAL, kallistatin, KLST, KSTKallikrein inhibitor, member 4, PI-4, PI4Peptidase inhibitor 4, protease inhibitor 4 (kallistatin), serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, Serpin A4, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin) | |
| SERPINA4 | |
| IgG | |
| Affinity Purified | |
| 48 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_006206 | |
| 5267 | |
| Synthetic peptide directed towards the middle region of human SERPINA4. Peptide sequence KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title