Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Serpin I2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Serpin I2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158047
|
Novus Biologicals
NBP158047 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Serpin I2 Polyclonal specifically detects Serpin I2 in Human samples. It is validated for Western Blot.Specifications
| Serpin I2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MEPIpancpin, Myoepithelium-derived serine protease inhibitor, Pancpin, Pancreas-specific protein TSA2004, Peptidase inhibitor 14, PI-14, PI14clade I (neuroserpin), member 2, protease inhibitor 14, serine (or cysteine) proteinase inhibitor, clade I (pancpin), member 2, serpin I2, serpin peptidase inhibitor, clade I (pancpin), member 2, SERPIN12 | |
| SERPINI2 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O75830 | |
| 5276 | |
| Synthetic peptides corresponding to SERPINI2(serpin peptidase inhibitor, clade I (pancpin), member 2) The peptide sequence was selected from the middle region of SERPINI2. Peptide sequence LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title