Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Serpin I2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Serpin I2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP158047
View Documents
Novus Biologicals
NBP158047
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Serpin I2 Polyclonal specifically detects Serpin I2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Serpin I2
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
MEPIpancpin, Myoepithelium-derived serine protease inhibitor, Pancpin, Pancreas-specific protein TSA2004, Peptidase inhibitor 14, PI-14, PI14clade I (neuroserpin), member 2, protease inhibitor 14, serine (or cysteine) proteinase inhibitor, clade I (pancpin), member 2, serpin I2, serpin peptidase inhibitor, clade I (pancpin), member 2, SERPIN12
SERPINI2
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
O75830
5276
Synthetic peptides corresponding to SERPINI2(serpin peptidase inhibitor, clade I (pancpin), member 2) The peptide sequence was selected from the middle region of SERPINI2. Peptide sequence LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit