Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Serum Amyloid A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Serum Amyloid A4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158991
|
Novus Biologicals
NBP158991 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Serum Amyloid A4 Polyclonal specifically detects Serum Amyloid A4 in Human samples. It is validated for Western Blot.Specifications
| Serum Amyloid A4 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C-SAACSAAConstitutively expressed serum amyloid A protein, serum amyloid A-4 protein, serum amyloid A4, constitutive | |
| SAA4 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P35542 | |
| 6291 | |
| Synthetic peptides corresponding to SAA4(serum amyloid A4, constitutive) The peptide sequence was selected from the middle region of SAA4. Peptide sequence AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title