Seryl tRNA synthetase Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157539

Catalog No. NBP157539

Description

Seryl tRNA synthetase Polyclonal specifically detects Seryl tRNA synthetase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Seryl tRNA synthetase
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5T5C8
• Gene Symbols: SARS
• Immunogen: Synthetic peptides corresponding to SARS (seryl-tRNA synthetase) The peptide sequence was selected from the middle region of SARS. Peptide sequence SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL.
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 6301
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 92%; Rat: 92%; Xenopus: 85%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Form: Purified