Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Seryl tRNA synthetase Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | Seryl tRNA synthetase |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157539
|
Novus Biologicals
NBP157539 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
Seryl tRNA synthetase Polyclonal specifically detects Seryl tRNA synthetase in Human samples. It is validated for Western Blot.Specifications
| Seryl tRNA synthetase | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 6.1.1.11, FLJ36399, serine-tRNA ligase, Serine--tRNA ligase, SERRS, SERSserine tRNA ligase 1, cytoplasmic, Seryl-tRNA Ser/Sec synthetase, seryl-tRNA synthetase, seryl-tRNA synthetase, cytoplasmic, Seryl-tRNA(Ser/Sec) synthetase | |
| SARS | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| Q5T5C8 | |
| 6301 | |
| Synthetic peptides corresponding to SARS (seryl-tRNA synthetase) The peptide sequence was selected from the middle region of SARS. Peptide sequence SQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title