Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SET Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15820120UL

 View more versions of this product

Catalog No. NBP1582020


Add to Cart

Description

Description

SET Polyclonal specifically detects SET in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.
Specifications

Specifications

SET
Polyclonal
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
B2RCX0
SET
Synthetic peptides corresponding to SET(SET nuclear oncogene) The peptide sequence was selected from the N terminal of SET. Peptide sequence IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT.
20 μL
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
6418
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
2PP2A, HLA-DR-associated protein II, I2PP2A, I-2PP2A, IGAAD, Inhibitor of granzyme A-activated DNase, inhibitor-2 of protein phosphatase-2A, IPP2A2, PHAPIITAF-I, Phosphatase 2A inhibitor I2PP2A, protein phosphatase type 2A inhibitor, protein SET, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), TAF-IBETA, Template-activating factor I, Template-Activating Factor-I, chromatin remodelling factor
Rabbit
Affinity Purified
RUO
Primary
Human, Mouse
IgG
Product Suggestions

Product Suggestions

SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit