Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | SETD4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18004620
|
Novus Biologicals
NBP18004620UL |
20 μL |
Each for $152.22
|
|
NBP180046
|
Novus Biologicals
NBP180046 |
100 μL |
Each for $436.00
|
|
Description
SETD4 Polyclonal specifically detects SETD4 in Human samples. It is validated for Western Blot.Specifications
SETD4 | |
Polyclonal | |
Rabbit | |
NP_059134 | |
54093 | |
Synthetic peptide directed towards the C terminal of human C21ORF18. Peptide sequence LTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETN. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4 | |
SETD4 | |
IgG | |
Affinity Purified | |
50 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title