Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SETD4 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP18004520UL

 View more versions of this product

Catalog No. NBP18004520


Add to cart

Description

Description

SETD4 Polyclonal antibody specifically detects Antigen in Human, Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

SETD4
Unconjugated
PBS & 2% Sucrose. with No Preservative
C21orf18, C21orf27, chromosome 21 open reading frame 18, chromosome 21 open reading frame 27, SET domain containing 4, SET domain-containing protein 4
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
54093
Western Blot
Western Blot 1:1000
Affinity Purified
SETD4
Synthetic peptide directed towards the C terminal of human SETD4. Peptide sequence VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH.
32 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human, Mouse
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit