Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SETD5 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SETD5
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP174109
View Documents
Novus Biologicals
NBP174109
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

SETD5 Polyclonal specifically detects SETD5 in Rat samples. It is validated for Western Blot.
Specifications

Specifications

SETD5
Western Blot
Unconjugated
RUO
D4A2W7
55209
Synthetic peptides corresponding to the N terminal of Setd5. Immunizing peptide sequence ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
DKFZp686J18276, FLJ10707, KIAA1757, SET domain containing 5, SET domain-containing protein 5
SETD5
IgG
Affinity Purified
160 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit