Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SETD5 Rabbit anti-Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SETD5 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP174109
|
Novus Biologicals
NBP174109 |
100 μL |
Each of 1 for $436.00
|
|
Description
SETD5 Polyclonal specifically detects SETD5 in Rat samples. It is validated for Western Blot.Specifications
SETD5 | |
Western Blot | |
Unconjugated | |
RUO | |
D4A2W7 | |
55209 | |
Synthetic peptides corresponding to the N terminal of Setd5. Immunizing peptide sequence ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686J18276, FLJ10707, KIAA1757, SET domain containing 5, SET domain-containing protein 5 | |
SETD5 | |
IgG | |
Affinity Purified | |
160 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title