Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SEZ6L2/BSRP-A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310995100UL
Description
SEZ6L2/BSRP-A Polyclonal specifically detects SEZ6L2/BSRP-A in Human samples. It is validated for Western Blot.Specifications
SEZ6L2/BSRP-A | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
seizure 6-like protein 2, seizure related 6 homolog (mouse)-like 2, UNQ1903/PRO4349 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human SEZ6L2/BSRP-A (NP_001107571). Peptide sequence AGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKCALKYEP | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
26470 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction