Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SF-1/NR5A1/Steroidogenic Factor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP152823

 View more versions of this product

Catalog No. NBP152823


Add to cart

Description

Description

SF-1/NR5A1/Steroidogenic Factor 1 Polyclonal antibody specifically detects SF-1/NR5A1/Steroidogenic Factor 1 in Human, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Specifications

Specifications

SF-1/NR5A1/Steroidogenic Factor 1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
NR5A1
Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA.
52 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 90%; Canine: 85%; Pig: 84%; Rabbit: 78%.
Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat, Sheep
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Western Blot 0.2-1 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
Q13285
AD4BPSTF-1, Adrenal 4-binding protein, ELP, FTZ1adrenal 4 binding protein, FTZF1nuclear receptor AdBP4, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, nuclear receptor subfamily 5, group A, member 1, SF-1POF7, SF1steroidogenic factor 1, Steroid hormone receptor Ad4BP, steroidogenic factor-1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
2516
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit