Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SF3B14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | SF3B14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15722720
|
Novus Biologicals
NBP15722720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157227
|
Novus Biologicals
NBP157227 |
100 μL |
Each for $487.50
|
|
|||||
Description
SF3B14 Polyclonal specifically detects SF3B14 in Human samples. It is validated for Western Blot.Specifications
| SF3B14 | |
| Polyclonal | |
| Rabbit | |
| Q7RTV0 | |
| 51639 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| HSPC175, Ht006, P14, pre-mRNA branch site protein p14, SAP14, SF3b 14 kDa subunit, SF3B14a, spliceosome-associated protein, 14 kDa subunit, splicing factor 3B, 14 kDa subunit | |
| Synthetic peptides corresponding to SF3B14(splicing factor 3B, 14 kDa subunit) The peptide sequence was selected from the middle region of SF3B14. Peptide sequence HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title