Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SF3B14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SF3B14
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157226
View Documents
Novus Biologicals
NBP157226
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

SF3B14 Polyclonal specifically detects SF3B14 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SF3B14
Polyclonal
Rabbit
Q9Y3B4
51639
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
HSPC175, Ht006, P14, pre-mRNA branch site protein p14, SAP14, SF3b 14 kDa subunit, SF3B14a, spliceosome-associated protein, 14 kDa subunit, splicing factor 3B, 14 kDa subunit
Synthetic peptides corresponding to SF3B14(splicing factor 3B, 14 kDa subunit) The peptide sequence was selected from the N terminal of SF3B14. Peptide sequence MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit