Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SF3B14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | SF3B14 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157226
|
Novus Biologicals
NBP157226 |
100 μL |
Each of 1 for $436.00
|
|
Description
SF3B14 Polyclonal specifically detects SF3B14 in Human samples. It is validated for Western Blot.Specifications
SF3B14 | |
Polyclonal | |
Rabbit | |
Q9Y3B4 | |
51639 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
HSPC175, Ht006, P14, pre-mRNA branch site protein p14, SAP14, SF3b 14 kDa subunit, SF3B14a, spliceosome-associated protein, 14 kDa subunit, splicing factor 3B, 14 kDa subunit | |
Synthetic peptides corresponding to SF3B14(splicing factor 3B, 14 kDa subunit) The peptide sequence was selected from the N terminal of SF3B14. Peptide sequence MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title