Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

sFRP-3/FRZB Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen sFRP-3/FRZB
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17955220
View Documents
Novus Biologicals
NBP17955220UL
20 μL
Each for $152.22
N/A
NBP179552
View Documents
Novus Biologicals
NBP179552
100 μL
Each for $493.00
N/A
Description

Description

sFRP-3/FRZB Polyclonal specifically detects sFRP-3/FRZB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

sFRP-3/FRZB
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FIZ, FREOS1, Frezzled, Fritz, frizzled-related protein, Frizzled-related protein 1, FRP, FRP-3, FrzB-1, FRZB1sFRP-3, FRZB-PEN, FZRB, hFIZ, secreted frizzled-related protein 3, SFRP3frezzled, SRFP3frizzled homolog-related
FRZB
IgG
Affinity Purified
36 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
NP_001454
2487
Synthetic peptide directed towards the middle region of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit