SFRS8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157466

Catalog No. NBP157466

Description

SFRS8 Polyclonal specifically detects SFRS8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SFRS8
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B2RN45
• Gene Symbols: SFSWAP
• Immunogen: Synthetic peptides corresponding to SFRS8(splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog, Drosophila)) The peptide sequence was selected from the N terminal of SFRS8. Peptide sequence LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: Drosophila homolog), Drosophila), SFRS8, Splicing factor, arginine/serine-rich 8, splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot, splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog, splicing factor, suppressor of white-apricot homolog, splicing factor, suppressor of white-apricot homolog (Drosophila), Suppressor of white apricot protein homolog, SWAPMGC167082
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6433
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.